Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1A, chloroplastic (CAB1A)

This Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1A, chloroplastic (CAB1A) spans the amino acid sequence from region 35-265.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 1A, chloroplastic, LHCII type I CAB-1A, LHCP

UniProt

P14274

Expression Region

35-265

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKAVAKSAPSSSPWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVHA QSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEI KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bicyclo[3.2.1]octanone
TRC-B382840-250MG 250 mg

3-Bicyclo[3.2.1]octanone

Sign In for Pricing
View Details
Glycerol, 1,3-Diheptanoate
TRC-G454420-50MG 50 mg

Glycerol, 1,3-Diheptanoate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS704703 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Neurofilament (NF-H) (RT-97), CF405S conjugate, 0.1mg/mL
BNC040454-500 1x 500 µL

Neurofilament (NF-H) (RT-97), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALDOB Antibody
OC-1764-01 50 μL

ALDOB Antibody

Sign In for Pricing
View Details
ALDOB Antibody
OC-1764-02 100 µL

ALDOB Antibody

Sign In for Pricing
View Details