Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1A, chloroplastic (CAB1A)

This Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1A, chloroplastic (CAB1A) spans the amino acid sequence from region 35-265.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 1A, chloroplastic, LHCII type I CAB-1A, LHCP

UniProt

P14274

Expression Region

35-265

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKAVAKSAPSSSPWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVHA QSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEI KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF664 activation kit by CRISPRa
GA115491 1 Kit

Human ZNF664 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene A CHO
HA110006.5G 5 g

Polystyrene A CHO

Sign In for Pricing
View Details
Dithiocarbonic Acid S,S'-Diethyl Ester
TRC-D493180-100MG 100 mg

Dithiocarbonic Acid S,S'-Diethyl Ester

Sign In for Pricing
View Details
RIPK3 Antibody
OC-565-01 50 μL

RIPK3 Antibody

Sign In for Pricing
View Details
RIPK3 Antibody
OC-565-02 100 µL

RIPK3 Antibody

Sign In for Pricing
View Details
RIPK3 Antibody
OC-565-03 1 mL

RIPK3 Antibody

Sign In for Pricing
View Details