Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Physcomitrella patens subsp. patens Chlorophyll a-b binding protein, chloroplastic

This Recombinant Physcomitrella patens subsp. patens Chlorophyll a-b binding protein, chloroplastic spans the amino acid sequence from region 39-269.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein, chloroplastic, LHCII type I CAB, LHCP

UniProt

P20866

Expression Region

39-269

Origin

Physcomitrella patens subsp. patens (Moss)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RRTVSKSAGSDTIWYGADRPKFLGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNR ELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQ SILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIK NGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVANNAWAYAPTSPPGTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ANXA7 Antibody
RC-4226-01 50 μL

Recombinant ANXA7 Antibody

Sign In for Pricing
View Details
Recombinant ANXA7 Antibody
RC-4226-02 100 µL

Recombinant ANXA7 Antibody

Sign In for Pricing
View Details
Recombinant ANXA7 Antibody
RC-4226-03 1 mL

Recombinant ANXA7 Antibody

Sign In for Pricing
View Details
Orosomucoid 2 (ORM2) (NM_000608) Human Over-expression Lysate
LC424609 20 µg

Orosomucoid 2 (ORM2) (NM_000608) Human Over-expression Lysate

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), 0.2mg/mL
BNUB1961-500 1x 500 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), 0.2mg/mL

Sign In for Pricing
View Details
Human CA12 activation kit by CRISPRa
GA100537 1 Kit

Human CA12 activation kit by CRISPRa

Sign In for Pricing
View Details