Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Physcomitrella patens subsp. patens Chlorophyll a-b binding protein, chloroplastic

This Recombinant Physcomitrella patens subsp. patens Chlorophyll a-b binding protein, chloroplastic spans the amino acid sequence from region 39-269.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein, chloroplastic, LHCII type I CAB, LHCP

UniProt

P20866

Expression Region

39-269

Origin

Physcomitrella patens subsp. patens (Moss)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RRTVSKSAGSDTIWYGADRPKFLGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNR ELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQ SILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIK NGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVANNAWAYAPTSPPGTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SFRS15 (SCAF4) activation kit by CRISPRa
GA111511 1 Kit

Human SFRS15 (SCAF4) activation kit by CRISPRa

Sign In for Pricing
View Details
Dextran (Technical Grade~ 4K)
TRC-D299105-100G 100 g

Dextran (Technical Grade~ 4K)

Sign In for Pricing
View Details
Human PHF20L1 activation kit by CRISPRa
GA109569 1 Kit

Human PHF20L1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Bone
CS648998 5x 5 µm

Frozen Tissue Sections, Bone

Sign In for Pricing
View Details
Diethyl-d10-amine
TRC-D443488-500MG 500 mg

Diethyl-d10-amine

Sign In for Pricing
View Details
Recombinant Human FGF-10 protein (His Tag)
PKSH034152-01 20 µg

Recombinant Human FGF-10 protein (His Tag)

Sign In for Pricing
View Details