Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Petunia sp. Chlorophyll a-b binding protein 13, chloroplastic (CAB13)

This Recombinant Petunia sp. Chlorophyll a-b binding protein 13, chloroplastic (CAB13) spans the amino acid sequence from region 35-266.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 13, chloroplastic, LHCII type I CAB-13, LHCP

UniProt

P04779

Expression Region

35-266

Origin

Petunia sp. (Petunia)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPATFAK NRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFKEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELEVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S-(+)-2-Amino-1-propanol
TRC-A628125-25G 25 g

S-(+)-2-Amino-1-propanol

Sign In for Pricing
View Details
NF-KB p65 Rabbit Monoclonal antibody
AMRe03290-01 1 Each

NF-KB p65 Rabbit Monoclonal antibody

Sign In for Pricing
View Details
NF-KB p65 Rabbit Monoclonal antibody
AMRe03290-02 50 µL

NF-KB p65 Rabbit Monoclonal antibody

Sign In for Pricing
View Details
NF-KB p65 Rabbit Monoclonal antibody
AMRe03290-03 100 µL

NF-KB p65 Rabbit Monoclonal antibody

Sign In for Pricing
View Details
SUMO-3 Antibody
F42017-0.08ML 0.08 mL

SUMO-3 Antibody

Sign In for Pricing
View Details
EphA6 Protein Lysate (Human) with C-Ha Tag
19359031 100 µg

EphA6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details