Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 1, chloroplastic (LHCB1.3)
This Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 1, chloroplastic (LHCB1.3) spans the amino acid sequence from region 36-267.
Product Specifications
Product Name Alternative
Chlorophyll a-b binding protein 1, chloroplastic, Chlorophyll a-b protein 140, CAB-140, LHCII type I CAB-1
UniProt
P04778
Expression Region
36-267
Origin
Arabidopsis thaliana (Mouse-ear cress)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740043-100 1x 100 µL
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882899-500 1x 500 µL
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740955-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 