Recombinant Pichia pastoris Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)
This Recombinant Pichia pastoris Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 37-268.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39
UniProt
C4QWY8
Expression Region
37-268
Origin
Pichia pastoris (strain GS115 / ATCC 20864) (Yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SNHPSSSFNNDGGPKVRHFLFVGLVGTMLFVLVVNKINEQDPKTSLAKKKNTYSEQEWES YVAGLKRKKQRFDSSSNKEFYAVPFANKNPKQIENLKRKVSKSSSQEDVGVVDINELIAK QMNNSESAYGLLLKTTLVENDPSSQSCTYSFNWNLAKGIFSKLVCDELTRMINESPQLDR FLLLNFPNNLPEAIKFEQDVANITELIVFNEEQKEDVVVKYFDTVDKVSISK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880204-500 1x 500 µL
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 