Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2010 (AF_2010)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2010 (AF_2010) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2010

UniProt

O28269

Expression Region

1-232

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPDTEEQTGLTIYLYPVIAWIILVTKIESGLRTRTFPVVHGDEGNNLIPLPEDVKNIRI VQSWPDTFLAKATVGAETIDMGIHVSPDVEALKKEAIELIKHKGSLRKAKKDAERESIVS GWFQSKFQSELLNLKKGWRIRGIVRAESPESKTLFNIELIKRVERRKDASHLRSGVFTPY QKSRIEDIPLSQRKIEPGEVDVPIPYDGIYRIAISPNVKTTYFVELFVEKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDR89 activation kit by CRISPRa
GA114372 1 Kit

Human WDR89 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Alpha-1-Antitrypsin (a1AT) ELISA Kit
RD-a1AT-Hu-01 96 Tests

Human Alpha-1-Antitrypsin (a1AT) ELISA Kit

Sign In for Pricing
View Details
Human Alpha-1-Antitrypsin (a1AT) ELISA Kit
RD-a1AT-Hu-02 48 Tests

Human Alpha-1-Antitrypsin (a1AT) ELISA Kit

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD563655 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Polystyrene A FMP
HA50056008.25G 25 g

Polystyrene A FMP

Sign In for Pricing
View Details
Sarcosine Ethyl Ester Hydrochloride
TRC-S140510-10G 10 g

Sarcosine Ethyl Ester Hydrochloride

Sign In for Pricing
View Details