Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2010 (AF_2010)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2010 (AF_2010) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2010

UniProt

O28269

Expression Region

1-232

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPDTEEQTGLTIYLYPVIAWIILVTKIESGLRTRTFPVVHGDEGNNLIPLPEDVKNIRI VQSWPDTFLAKATVGAETIDMGIHVSPDVEALKKEAIELIKHKGSLRKAKKDAERESIVS GWFQSKFQSELLNLKKGWRIRGIVRAESPESKTLFNIELIKRVERRKDASHLRSGVFTPY QKSRIEDIPLSQRKIEPGEVDVPIPYDGIYRIAISPNVKTTYFVELFVEKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ELAVL4 Antibody
RN-14687-01 50 μL

Recombinant ELAVL4 Antibody

Sign In for Pricing
View Details
Recombinant ELAVL4 Antibody
RN-14687-02 100 µL

Recombinant ELAVL4 Antibody

Sign In for Pricing
View Details
Recombinant ELAVL4 Antibody
RN-14687-03 1 mL

Recombinant ELAVL4 Antibody

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), CF568 conjugate, 0.1mg/mL
BNC681730-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1730), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human GADD45A/DDIT-1 Protein (His & GST Tag)
PKSH031234 100 µg

Recombinant Human GADD45A/DDIT-1 Protein (His & GST Tag)

Sign In for Pricing
View Details
Nirmatrelvir R,R-isomer
TRC-N452480-25MG 25 mg

Nirmatrelvir R,R-isomer

Sign In for Pricing
View Details