Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ippy virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Ippy virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 264-495.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2, 6. GP2

UniProt

Q27YE4

Expression Region

264-495

Origin

Ippy virus (isolate Rat/Central African Republic/Dak An B 188 d/1970) (IPPYV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

STFTWSLSDSSGTENPGGYCLTRWMLFAADLKCFGNTAIAKCNLNHDEEFCDMLRLIDFN KQALKTFKSEVNHGLQLITKAINALINDQLIMKNHLRDLMGIPYCNYSKFWYLNDTRTGR VSLPKCWMISNGTYLNETHFSDEIEQEADNMITEMLRKEYQERQGKTPLGLVDLFIFSTS FYSITVFLHLIKIPTHRHIVGQGCPKPHRLNSRAICSCGAYKQPGLPTKWKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSR1 Rabbit Polyclonal Antibody
MBS9465889-01 0.05 mL

SSR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SSR1 Rabbit Polyclonal Antibody
MBS9465889-02 0.1 mL

SSR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SSR1 Rabbit Polyclonal Antibody
MBS9465889-03 5x 0.1 mL

SSR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1- (1-Ethyl-1H-imidazol-2-yl) ethan-1-one
WMB06101-01 50 mg

1- (1-Ethyl-1H-imidazol-2-yl) ethan-1-one

Sign In for Pricing
View Details
1- (1-Ethyl-1H-imidazol-2-yl) ethan-1-one
WMB06101-02 0.5 g

1- (1-Ethyl-1H-imidazol-2-yl) ethan-1-one

Sign In for Pricing
View Details
Hedgehog-interacting protein (HHIP) Mouse ELISA Kit
D9683 96 Tests

Hedgehog-interacting protein (HHIP) Mouse ELISA Kit

Sign In for Pricing
View Details