Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ippy virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Ippy virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 264-495.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2, 6. GP2

UniProt

Q27YE4

Expression Region

264-495

Origin

Ippy virus (isolate Rat/Central African Republic/Dak An B 188 d/1970) (IPPYV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

STFTWSLSDSSGTENPGGYCLTRWMLFAADLKCFGNTAIAKCNLNHDEEFCDMLRLIDFN KQALKTFKSEVNHGLQLITKAINALINDQLIMKNHLRDLMGIPYCNYSKFWYLNDTRTGR VSLPKCWMISNGTYLNETHFSDEIEQEADNMITEMLRKEYQERQGKTPLGLVDLFIFSTS FYSITVFLHLIKIPTHRHIVGQGCPKPHRLNSRAICSCGAYKQPGLPTKWKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBAS Rabbit Polyclonal Antibody (BF488)
orb2525931 100 µL

GBAS Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
CD8B Protein (C-Fc, Human)
P502309 100 µg

CD8B Protein (C-Fc, Human)

Sign In for Pricing
View Details
Anti-MMACHC Antibody Picoband®, Cy3 Conjugate
A03398-1-Cy3 100 µg/Vial

Anti-MMACHC Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Ru (dpp) 3 (PF6) 2
TYD-01807-01 100 mg

Ru (dpp) 3 (PF6) 2

Sign In for Pricing
View Details
Ru (dpp) 3 (PF6) 2
TYD-01807-02 200 mg

Ru (dpp) 3 (PF6) 2

Sign In for Pricing
View Details
Ru (dpp) 3 (PF6) 2
TYD-01807-03 50 mg

Ru (dpp) 3 (PF6) 2

Sign In for Pricing
View Details