Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 3, chloroplastic (LHCB1.2)
This Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 3, chloroplastic (LHCB1.2) spans the amino acid sequence from region 36-267.
Product Specifications
Product Name Alternative
Chlorophyll a-b binding protein 3, chloroplastic, Chlorophyll a-b protein 180, CAB-180, LHCII type I CAB-3
UniProt
Q8VZ87
Expression Region
36-267
Origin
Arabidopsis thaliana (Mouse-ear cress)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880918-500 1x 500 µL
CD44 Standard (HCAM/918), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040827-100 1x 100 µL
Involucrin (IVRN/827), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401948-500 1x 500 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details