Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ascaris suum Cytochrome c oxidase subunit 2 (COII)

This Recombinant Ascaris suum Cytochrome c oxidase subunit 2 (COII) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

P24882

Expression Region

1-232

Origin

Ascaris suum (Pig roundworm) (Ascaris lumbricoides)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNFFQDFNLLFSSSLFSSYMDWFYNFNCSLLFGVLSFVSTMFVYLLLSSFYFKSKKIEY QFGELLCSVFPTLILVMQMVPSLSLLYYYGLMNLDSSLTVKVTGHQWYWSYEFSDIPGLE FDSYMKSLDQLELGEPRLLEVDNRCVVPCDVNIRFCITSGDVIHSWALPSMSIKLDAMSG ILSTLSYSFPVVGVFYGQCSEICGANHSFMPVALEVTLLDNFKSWCVGLLSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF568 conjugate, 0.1mg/mL
BNC680764-100 1x 100 µL

CD79a (IGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details