Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 2, chloroplastic (LHCB1.1)
This Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 2, chloroplastic (LHCB1.1) spans the amino acid sequence from region 36-267.
Product Specifications
Product Name Alternative
Chlorophyll a-b binding protein 2, chloroplastic, Chlorophyll a-b protein 165, CAB-165, LHCII type I CAB-2
UniProt
P0CJ48
Expression Region
36-267
Origin
Arabidopsis thaliana (Mouse-ear cress)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470687-500 1x 500 µL
Cytokeratin 8 (H1 + TS1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882151-500 1x 500 µL
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880836-500 1x 500 µL
Cytokeratin 18 (KRT18/836), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details