Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Chlorophyll a-b binding protein, chloroplastic

This Recombinant Spinacia oleracea Chlorophyll a-b binding protein, chloroplastic spans the amino acid sequence from region 36-267.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein, chloroplastic, LHCII type I CAB, LHCP

UniProt

P12333

Expression Region

36-267

Origin

Spinacia oleracea (Spinach)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r181 Mouse Gene Knockout Kit (CRISPR)
KN518973 1 Kit

Vmn1r181 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,3-Diethylurea
TRC-D476628-250MG 250 mg

1,3-Diethylurea

Sign In for Pricing
View Details
A530064D06Rik Mouse Gene Knockout Kit (CRISPR)
KN500557 1 Kit

A530064D06Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Histone H1 (HH1/957), 0.2mg/mL
BNUB0957-500 1x 500 µL

Histone H1 (HH1/957), 0.2mg/mL

Sign In for Pricing
View Details
CPNE1 (NM_152926) Human Recombinant Protein
TP321253M 100 µg

CPNE1 (NM_152926) Human Recombinant Protein

Sign In for Pricing
View Details
Tas2r118 Mouse Gene Knockout Kit (CRISPR)
KN517203 1 Kit

Tas2r118 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details