Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 258-489.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2

UniProt

P19240

Expression Region

258-489

Origin

Mopeia virus (MOPV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFN KQAISKLRSEVQQSINLINKAVNALINDQLVMRNHLRDLMGIPYCNYSKFWYLNDTRTGR TSLPKCWLVTNGSYLNETQFSTEIEQEANNMFTDMLRKEYEKRQSTTPLGLVDLFVFSTS FYLISVFLHLIKIPTHRHIKGKPCPKPHRLNHMAICSCGFYKQPGLPTQWKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plakophilin 1 (10B2) Alexa Fluor® 790
sc-33636 AF790 200 µg/mL

Plakophilin 1 (10B2) Alexa Fluor® 790

Sign In for Pricing
View Details
EIF3E Recombinant Antibody, Cy5 Conjugated
bsm-62327R-Cy5-TR 20 µL

EIF3E Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Caspase 7 Antibody
orb1732202 100 µL

Caspase 7 Antibody

Sign In for Pricing
View Details
Recombinant Human NOX5 Protein, N-His
orb2962636-01 50 µg

Recombinant Human NOX5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NOX5 Protein, N-His
orb2962636-02 100 µg

Recombinant Human NOX5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NOX5 Protein, N-His
orb2962636-03 1 mg

Recombinant Human NOX5 Protein, N-His

Sign In for Pricing
View Details