Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 258-489.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2

UniProt

P19240

Expression Region

258-489

Origin

Mopeia virus (MOPV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFN KQAISKLRSEVQQSINLINKAVNALINDQLVMRNHLRDLMGIPYCNYSKFWYLNDTRTGR TSLPKCWLVTNGSYLNETQFSTEIEQEANNMFTDMLRKEYEKRQSTTPLGLVDLFVFSTS FYLISVFLHLIKIPTHRHIKGKPCPKPHRLNHMAICSCGFYKQPGLPTQWKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GATA Binding Protein 3 (GATA3) ELISA Kit
MBS455302-01 48 Tests

Human GATA Binding Protein 3 (GATA3) ELISA Kit

Sign In for Pricing
View Details
Human GATA Binding Protein 3 (GATA3) ELISA Kit
MBS455302-02 96 Tests

Human GATA Binding Protein 3 (GATA3) ELISA Kit

Sign In for Pricing
View Details
Human GATA Binding Protein 3 (GATA3) ELISA Kit
MBS455302-03 5x 96 Tests

Human GATA Binding Protein 3 (GATA3) ELISA Kit

Sign In for Pricing
View Details
Human GATA Binding Protein 3 (GATA3) ELISA Kit
MBS455302-04 10x 96 Tests

Human GATA Binding Protein 3 (GATA3) ELISA Kit

Sign In for Pricing
View Details
Phospho-NFKB2 (Ser866+Ser870) Rabbit pAb
E47R20198 100 µL

Phospho-NFKB2 (Ser866+Ser870) Rabbit pAb

Sign In for Pricing
View Details
Mouse Anti-Pig IgG (H&L) - AP
orb1786477-01 100 µL

Mouse Anti-Pig IgG (H&L) - AP

Sign In for Pricing
View Details