Recombinant Breda virus 1 Membrane protein (M)
This Recombinant Breda virus 1 Membrane protein (M) spans the amino acid sequence from region 1-233.
Product Specifications
Product Name Alternative
Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein
UniProt
O90305
Expression Region
1-233
Origin
Breda virus 1 (BRV-1)
Field of Research
Infectious Disease & Virology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFETNYWPFPDQAPNPFNAQVEQLSATENVYIFLTTLFGILQLVYVIFKLLCTMFPALHW SPIWRGLENFWLFLSLASLAIAYWWLPSMTFTGYWALTIIATILGLIMLIMMSVKFVSFV KLFYRTGSFAIAIRGPIVLVALDVTIKLHCTPFAILVKEVGNIFYLSEYCNKPLTAAQVA ALRICVGGQWFAYTRSTTTSAAKVAAANSTAKYHLFVLQGVAEYTQLSSVKFE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
037602-ML750 100 µL
KRR1, NT (KRR1, HRB2, KRR1 small subunit processome component homolog, HIV-1 Rev-binding protein 2, KRR-R motif-containing protein 1, Rev-interacting protein 1) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
038945-Biotin 200 µL
NFKBIL1, ID (NFKBIL1, IKBL, NF-kappa-B inhibitor-like protein 1, Inhibitor of kappa B-like protein, Nuclear factor of kappa light polypeptide gene enhancer in B Cells inhibitor-like 1) (Biotin) discontinued
Sign In for Pricing
View Details MBS6295640-01 0.1 mL
ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 550)
Sign In for Pricing
View Details MBS6295640-02 5x 0.1 mL
ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 550)
Sign In for Pricing
View Details