Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Breda virus 1 Membrane protein (M)

This Recombinant Breda virus 1 Membrane protein (M) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

O90305

Expression Region

1-233

Origin

Breda virus 1 (BRV-1)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFETNYWPFPDQAPNPFNAQVEQLSATENVYIFLTTLFGILQLVYVIFKLLCTMFPALHW SPIWRGLENFWLFLSLASLAIAYWWLPSMTFTGYWALTIIATILGLIMLIMMSVKFVSFV KLFYRTGSFAIAIRGPIVLVALDVTIKLHCTPFAILVKEVGNIFYLSEYCNKPLTAAQVA ALRICVGGQWFAYTRSTTTSAAKVAAANSTAKYHLFVLQGVAEYTQLSSVKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-5 (Interleukin 5) BioAssayTM ELISA Kit (Rabbit) discontinued
356745-01 48 Tests

IL-5 (Interleukin 5) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
IL-5 (Interleukin 5) BioAssayTM ELISA Kit (Rabbit) discontinued
356745-02 96 Tests

IL-5 (Interleukin 5) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal CUGBP2 Antibody [Alexa Fluor 594]
NB600-204AF594 0.1 mL

Rabbit Polyclonal CUGBP2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
SGLT1/SLC5A1 Rabbit Polyclonal Antibody (Cy3)
orb2574548 100 µg

SGLT1/SLC5A1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
CRFM7 rabbit pAb
E28PN4471 100 µL

CRFM7 rabbit pAb

Sign In for Pricing
View Details
Chibby 3 CRISPR/Cas9 KO Plasmid (h)
sc-416141 20 µg

Chibby 3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details