Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Apoptosis regulator Bcl-2 (BCL2)

This Recombinant Chicken Apoptosis regulator Bcl-2 (BCL2) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Apoptosis regulator Bcl-2

UniProt

Q00709

Expression Region

1-233

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPAPAPAAAPAAVAAAGASSH HRPEPPGSAAASEVPPAEGLRPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTA HGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIATWMTEYLNRHLH NWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PLA1A Knockout HEK293T cell line
GTR15411641 1 Vial

Human PLA1A Knockout HEK293T cell line

Sign In for Pricing
View Details
FYCO1 Mouse Monoclonal Antibody [Clone ID: OTI8G7]
CF809860 100 µg

FYCO1 Mouse Monoclonal Antibody [Clone ID: OTI8G7]

Sign In for Pricing
View Details
mmu-miR-122-3p miRNA Antagomir
MBS8319385-01 10 nmol

mmu-miR-122-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-122-3p miRNA Antagomir
MBS8319385-02 20 nmol

mmu-miR-122-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-122-3p miRNA Antagomir
MBS8319385-03 5x 20 nmol

mmu-miR-122-3p miRNA Antagomir

Sign In for Pricing
View Details
Aquaporin 6 (AQP6) (NM_001652) Human Over-expression Lysate
LS000363-100ug 100 µg

Aquaporin 6 (AQP6) (NM_001652) Human Over-expression Lysate

Sign In for Pricing
View Details