Recombinant Zea mays Chlorophyll a-b binding protein M9, chloroplastic (CAB-M9)
This Recombinant Zea mays Chlorophyll a-b binding protein M9, chloroplastic (CAB-M9) spans the amino acid sequence from region 33-265.
Product Specifications
Product Name Alternative
Chlorophyll a-b binding protein M9, chloroplastic, LHCII type I CAB-M9, LHCP
UniProt
P27497
Expression Region
33-265
Origin
Zea mays (Maize)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
RKTAAKAKPAASSGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFA KNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLI HAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGGTFDPLGLADDPEAFADVKVK ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470681-100 1x 100 µL
Human Kappa Light Chain (HP6053), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882624-500 1x 500 µL
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details