Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tacaribe virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Tacaribe virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 250-482.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2

UniProt

P31842

Expression Region

250-482

Origin

Tacaribe virus (strain V7) (TCRV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AFFSWSLTDPLGNEAPGGYCLEKWMLVASELKCFGTLQCQVQPKSRLRVCDMLRLFDYNK NAIKTLNEETKTRVNVLSHTINALISDNLLMKNKIRELMSVPYCNYTRFWYVNHTLSGQH SLPRCWMIRNNSYLNSSEFRNEWILESDFLISEMLSKEYSERQGRTPITLVDICFWSTEF FISTLFLHLIGFPTHEHIRGEGCPLPHRLNSMGGCRCGKYLPLKKPTIWHRRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b Recombinant Rabbit monoclonal Antibody
HA750451 100 µL

CD11b Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Acetophenone-13C8
TRC-A164014-25MG 25 mg

Acetophenone-13C8

Sign In for Pricing
View Details
JPT1 (NM_001002033) Human Over-expression Lysate
LC424172 20 µg

JPT1 (NM_001002033) Human Over-expression Lysate

Sign In for Pricing
View Details
Viability PCR Starter Kit with PMAxxTM and Enhancer
#31076-X 1 Kit

Viability PCR Starter Kit with PMAxxTM and Enhancer

Sign In for Pricing
View Details
Ecoscint XR
LS-272 4 L

Ecoscint XR

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS805579 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details