Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 37, mitochondrial (AIM37)
This Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 37, mitochondrial (AIM37) spans the amino acid sequence from region 1-234.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 37, mitochondrial
UniProt
B5VQU2
Expression Region
1-234
Origin
Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVNFYDDVDESKSHGEFPLIPVVLQNSSELSVRTIPTGNEIIESVHLTKWLRKYRNALAS QLDRYEKGWQSKIANFRLQVQHVINYSRKNIFNVDSENKHTVVPGSLIALGAFFSGSIAV NRSNWGAKRLIFGHKSSILEKLCTSLPSRILLPWVLAAATFKYWAPQTSQNLVNATENDL LPADFVKSYHNTWKRIYEEGYVAKKCDLKRQIDQTLQKNIRYAREQLYEKLEQA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940501-100 1x 100 µL
Progesterone Receptor (PR501), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740718-100 1x 100 µL
HER-2 / CD340 (HRB2/718), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 