Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 65 (Tmem65)

This Recombinant Mouse Transmembrane protein 65 (Tmem65) spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

Transmembrane protein 65

UniProt

Q4VAE3

Expression Region

1-234

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRLLPLLGSRTARSLRPGPAAAPRLPSWCCCGRGLLALGVPGGPRLLGTHPKKEPMEAL NTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEALPPTPGQLRYVFFHNAIPFV GFGFLDNAIMIVAGTQIELSIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGL SIPDLTPKQVDMWQTRVSTHLGKAVGVTIGCILGMFPLIFFGGSEEDEKLETTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIN1 Antibody
CSB-PA008974-01 50 µg

GRIN1 Antibody

Sign In for Pricing
View Details
GRIN1 Antibody
CSB-PA008974-02 100 µg

GRIN1 Antibody

Sign In for Pricing
View Details
Monkey Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit
MBS7262874-01 48 Well

Monkey Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit

Sign In for Pricing
View Details
Monkey Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit
MBS7262874-02 96 Well

Monkey Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit

Sign In for Pricing
View Details
Monkey Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit
MBS7262874-03 5x 96 Well

Monkey Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit

Sign In for Pricing
View Details
Monkey Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit
MBS7262874-04 10x 96 Well

Monkey Ion Channel Sperm Associated Protein 2 (SPER2) ELISA Kit

Sign In for Pricing
View Details