Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cupixi virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Cupixi virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 247-480.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2, 6. GP2

UniProt

Q8B115

Expression Region

247-480

Origin

Cupixi virus (isolate Rat/Brasil/BeAn 119303/1970) (CPXV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AFFSWSLSDSTGVDMPGGYCLEKWMLIASELKCFGNTALAKCNLKHDSEFCDMIKLFDFN KNAISKLNNNTIEAVNQLTKTVNSLISDNLLMKNRLRELLKVPYCNYTRFWYVNHTRTGE HSLPKCWLVNNGSYLNESDFRNEWILESDHLISEMLSKEYQERQGRTPLTLVDLCFWSAV FYTTTLFLHLVGFPTHRHISGEPCPLPHRLNRHGACNCGRFKRLKKPLVWYKHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLEC2D activation kit by CRISPRa
GA109251 1 Kit

Human CLEC2D activation kit by CRISPRa

Sign In for Pricing
View Details
Dag1 Mouse Gene Knockout Kit (CRISPR)
KN304265BN 1 Kit

Dag1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAGE Antibody
KC-2798-01 50 μL

RAGE Antibody

Sign In for Pricing
View Details
RAGE Antibody
KC-2798-02 100 µL

RAGE Antibody

Sign In for Pricing
View Details
RAGE Antibody
KC-2798-03 1 mL

RAGE Antibody

Sign In for Pricing
View Details
DUSP6 Human Gene Knockout Kit (CRISPR)
KN206765BN 1 Kit

DUSP6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details