Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tamiami virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Tamiami virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 252-485.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2, 6. GP2

UniProt

Q8AYY5

Expression Region

252-485

Origin

Tamiami virus (isolate Rat/United States/W 10777/1964) (TAMV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFFTWSLSDAVGNDMPGGYCLEKWMLIASQLKCFGNTAVAKCNLNHDSEFCDMLRLFDFN RKAIETLQNKTRSQLNIAINAINSLISDNLLMKNRVKELMDIPFCNYTKFWYVNHTKLNH HSLPRCWLVKNGSYLNESEFRNDWLLESDHLISEILSREYEERQGRTPLSLVDVCFWSTL FYTASIFLHLIRIPTHRHIVGEGCPKPHRLRADSTCACGLYKQKRRPLKWVRSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Occludin (OCLN) Human Gene Knockout Kit (CRISPR)
KN206468BN 1 Kit

Occludin (OCLN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SHISAL2A (NM_001042693) Human Over-expression Lysate
LY421028 100 µg

SHISAL2A (NM_001042693) Human Over-expression Lysate

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF405S conjugate, 0.1mg/mL
BNC041778-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHC (SHC1) Rabbit Polyclonal Antibody
AP02794PU-N 100 µL

SHC (SHC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C10orf7 (CDC123) Rabbit Monoclonal Antibody
TA424181 100 µL

C10orf7 (CDC123) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), CF740 conjugate, 0.1mg/mL
BNC741882-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details