Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized HTH-type transcriptional regulator Mb1846 (Mb1846)

This Recombinant Uncharacterized HTH-type transcriptional regulator Mb1846 (Mb1846) spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

Uncharacterized HTH-type transcriptional regulator Mb1846

UniProt

P67439

Expression Region

1-234

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCQTCRVGKRRDAREQIEAKIVELGRRQLLDHGAAGLSLRAIARNLGMVSSAVYRYVSSR DELLTLLLVDAYSDLADTVDRARDDTVADSWSDDVIAIARAVRGWAVTNPARWALLYGSP VPGYHAPPDRTAGVATRVVGAFFDAIAAGIATGDIRLTDDVAPQPMSSDFEKIRQEFGFP GDDRVVTKCFLLWAGVVGAISLEVFGQYGADMLTDPGVVFDAQTRLLVAVLAEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (KRT7/760), CF568 conjugate, 0.1mg/mL
BNC680760-500 1x 500 µL

Cytokeratin 7 (KRT7/760), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C19orf50 (KXD1) (NM_001171948) Human Over-expression Lysate
LC432637 20 µg

C19orf50 (KXD1) (NM_001171948) Human Over-expression Lysate

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-100 1x 100 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,3-Dihydro-2-thioxo-1,3-bis-(2,3,5-tri-O-acetyl-b-D-ribofuranosyl)-4(1H)-pyrimidinone
TRC-D454720-500MG 500 mg

2,3-Dihydro-2-thioxo-1,3-bis-(2,3,5-tri-O-acetyl-b-D-ribofuranosyl)-4(1H)-pyrimidinone

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF488A conjugate, 0.1mg/mL
BNC880523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MELK Rabbit Polyclonal Antibody
AP20443PU-N 100 µg

MELK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details