Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium fredii Nodulation protein nolW (nolW)

This Recombinant Rhizobium fredii Nodulation protein nolW (nolW) spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

Nodulation protein nolW

UniProt

P33212

Expression Region

1-234

Origin

Rhizobium fredii (Sinorhizobium fredii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTTPIPFTPLHMFRRLLCVGLFLFAGIHTTLGATLPLPSTSYKYTVLDQDLSAALQEFG NNLKISVNISAEVKGRIRGRIPELSPREFLDRLTDLYDLQWYYDGVVLYVSAAKEAQTRM LVLSSVHFSAFKLALDKLDISDERYPVRPAPGNGLVLVSGPPRFIALIEQTLNGLLAVAQ AQPRATDTPARESVMVLFRGSSTTVVRGGRPEVFYTSEMLPENDDGGKAELSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF594 conjugate, 0.1mg/mL
BNC942406-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF488A conjugate, 0.1mg/mL
BNC882427-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details