Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae putative uncharacterized membrane protein YNL228W (YNL228W)

This Recombinant Saccharomyces cerevisiae putative uncharacterized membrane protein YNL228W (YNL228W) spans the amino acid sequence from region 24-258.

Product Specifications

Product Name Alternative

Putative uncharacterized membrane protein YNL228W

UniProt

P53862

Expression Region

24-258

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CPAIFTWLNSLFRLSNDSPHVVHTSIAEVGDIEDGRVDKDGVLFVDLEFFLGCLPFFFFA LVDQSSSSSVCKPLSPSDAKRSSNSLLRLSLVSSNDSDSSVSVSTFAFFFFFLFFLFFVF TCTFSSELTSSTSISISMLRLSSSLSSSEDDSASFLSISASSACNACRSISSFSLTLSSA ESNFSRSERLSNPSVMFSSSISFRISSIFFLCSLVFMWFFNCFSDLNVLLQIKHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2K2 Rabbit Polyclonal Antibody (Biotin)
orb2113702 100 µL

MAP2K2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Olfr1056 (NM_147018) Mouse Tagged ORF Clone Lentiviral Particle
MR215528L4V 200 µL

Olfr1056 (NM_147018) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KRT18P9 sgRNA CRISPR Lentivector set (Human)
K1171001 3x 1.0 µg

KRT18P9 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Psmg2 CRISPR Activation Plasmid (m)
sc-430690-ACT 20 µg

Psmg2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Recombinant Pongo abelii Vacuolar protein sorting-associated protein 26B (VPS26B)
MBS1474003-01 0.02 mg (E-Coli)

Recombinant Pongo abelii Vacuolar protein sorting-associated protein 26B (VPS26B)

Sign In for Pricing
View Details
Recombinant Pongo abelii Vacuolar protein sorting-associated protein 26B (VPS26B)
MBS1474003-02 0.02 mg (Yeast)

Recombinant Pongo abelii Vacuolar protein sorting-associated protein 26B (VPS26B)

Sign In for Pricing
View Details