Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-235.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q70XZ2

Expression Region

1-235

Origin

Amborella trichopoda

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWRSERIWIELITGSRKTSNLCWACILFLGSLGFLLVGTSSYLGRNLISLFPSQQILFF PQGIVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGRNRRIFFRF LMRDIRSIRMEVKEGIYPRRVLSIEIRSQGSIPLTRTDENFTPREIEQKAAELAYFLRVP IEVFRTKEWILSRHGVGNPRILFNTTDLSSEQLLIRSKHVSVRSYFRSLLFPVCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 zeta (YWHAZ) (NM_001135700) Human Over-expression Lysate
LC427674 20 µg

14-3-3 zeta (YWHAZ) (NM_001135700) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418E-01 50 Tests

APC Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
APC Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418E-02 100 Tests

APC Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
APC Anti-Mouse CD122 Antibody[TM-Beta 1]
AN00418E-03 2x 100 Tests

APC Anti-Mouse CD122 Antibody[TM-Beta 1]

Sign In for Pricing
View Details
GDPD1 Human Gene Knockout Kit (CRISPR)
KN423431 1 Kit

GDPD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzotriazol-1-yl-oxytripyrrolidinphosphonium Hexafluorophosphate
TRC-B207500-25G 25 g

Benzotriazol-1-yl-oxytripyrrolidinphosphonium Hexafluorophosphate

Sign In for Pricing
View Details