Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pirital virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Pirital virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 276-510.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2, 6. GP2

UniProt

Q8B119

Expression Region

276-510

Origin

Pirital virus (isolate Rat/Venezuela/VAV-488/1995) (PIRV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GFFTWDISDSSGQHVPGGYCLEQWAIVWAGIKCFDNSVMAKCNKDHNEEFCDTMRLFDFN QNAIKTLQLNVENSLNLMKKSINGLISDSLVIRNSLKQLAKIPYCNYTKFWYVNDTITGK HSLPQCWLVSNGSYLNETHFKNEWLWESQKLYNDMLLKEYEERQGNTPLALADLCFWSLV FFTTTVFFQLIGIPTHRHLIGEGCPKPHRLTSNSLCSCGFYKIPKKPFRWVRKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB22 Rabbit Polyclonal Antibody
orb158747-01 50 μL

ZBTB22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB22 Rabbit Polyclonal Antibody
orb158747-02 100 µL

ZBTB22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB22 Rabbit Polyclonal Antibody
orb158747-03 200 µL

ZBTB22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Hemoglobin subunit alpha (HBA) ELISA Kit
MBS9305652-01 48 Well

Porcine Hemoglobin subunit alpha (HBA) ELISA Kit

Sign In for Pricing
View Details
Porcine Hemoglobin subunit alpha (HBA) ELISA Kit
MBS9305652-02 96 Well

Porcine Hemoglobin subunit alpha (HBA) ELISA Kit

Sign In for Pricing
View Details
Porcine Hemoglobin subunit alpha (HBA) ELISA Kit
MBS9305652-03 5x 96 Well

Porcine Hemoglobin subunit alpha (HBA) ELISA Kit

Sign In for Pricing
View Details