Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 215 (Tmem215)

This Recombinant Mouse Transmembrane protein 215 (Tmem215) spans the amino acid sequence from region 1-235.

Product Specifications

Product Name Alternative

Transmembrane protein 215

UniProt

A7E1Z1

Expression Region

1-235

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRPDDINPRTGLVVALVSVFLVFGFMFTVSGMKGETLGNIPLLAIGPAICLPGIAAIALA RKTEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGK QLPQGPGEVPMASSVTTPTPTEEGECQSLVQSGRQEETSRYLDGYCPSASSLAYSALDAK CSAWDRSDRPEPEDSIFFVPQDSIIVCSYKQNSPYDRYCCYINQSQGRWDHETIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL
BNC040914-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEIS2 Rabbit Polyclonal Antibody
TA378455 100 µL

MEIS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: OTI6B8]
CF809364 100 µg

Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: OTI6B8]

Sign In for Pricing
View Details
tert-Butyl (R)-4,5-Diamino-5-oxopentanoate Hydrochloride
TRC-B677320-2.5G 2.5 g

tert-Butyl (R)-4,5-Diamino-5-oxopentanoate Hydrochloride

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein (His Tag) (D614G)
PKSR030531 100 µg

Recombinant SARS-CoV-2 S1 Protein (His Tag) (D614G)

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G9]
TA802065AM 100 µL

CD4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G9]

Sign In for Pricing
View Details