Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Left-right determination factor 2 (LEFTY2)

Product Specifications

Product Name Alternative

Endometrial bleeding-associated factor (Left-right determination factor A) (Protein lefty-2) (Protein lefty-A) (Transforming growth factor beta-4) (TGF-beta-4) (EBAF) (LEFTA) (LEFTYA) (TGFB4)

Abbreviation

Recombinant Human LEFTY2 protein

Gene Name

LEFTY2

UniProt

O00292

Expression Region

77-366aa

Organism

Homo sapiens (Human)

Target Sequence

RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Required for left-right asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.8 kDa

References & Citations

"Nodal signals to Smads through Cripto-dependent and Cripto-independent mechanisms." Yeo C., Whitman M. Mol. Cell 7:949-957 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)
MBS2071956-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)
MBS2071956-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)
MBS2071956-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)
MBS2071956-04 1 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)
MBS2071956-05 5 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)
MBS2071956-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 9 (PTPN9)

Sign In for Pricing
View Details