Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 060L (IIV6-060L)

This Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 060L (IIV6-060L) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Uncharacterized protein 060L

UniProt

O55704

Expression Region

1-236

Origin

Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKNKSPLLNESEKMMSEMLPMKVSQSKLNYEEKVYIPTTIRNRKQHCFRRFFPYIALFQ IIMLIILLILYFCFPNLFYSTNFNTNFNTSLLQNNSIETKLNSIPPQNNSQKTEVPIILN YTTQKTEVTEPIIINNTTEEIETQTIMIPKSTDQTQTIISAKTTAIISPPETSETIAQVL KNSDKREHDDEELSFTTEMETITTETETSSTIPHLRSLPIKSESSMETTSEETDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-100 1x 100 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (LN-2 + CLIP/813), CF740 conjugate, 0.1mg/mL
BNC741207-500 1x 500 µL

CD74 (LN-2 + CLIP/813), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF647 conjugate, 0.1mg/mL
BNC472205-500 1x 500 µL

PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details