Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat CD320 antigen (Cd320)

This Recombinant Rat CD320 antigen (Cd320) spans the amino acid sequence from region 29-264.

Product Specifications

Product Name Alternative

CD320 antigen, Transcobalamin receptor, TCblR, CD_antigen= CD320

UniProt

Q5HZW5

Expression Region

29-264

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APAPTSAPAHTLVQVSGPRAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRI EPCAQNRQCQPQPALPCSCDNISGCSAGSDKNLNCSRSPCQEGELRCILDDVCIPHTWRC DGHPDCPDSSDELSCDTDTETDKIFQEENATTSMSSMIVEKETSFRNVTVASAGHPSRNP NAYGVIAAAGVLSAILVSATILILLRLRGQGYLPPTGLLVAVKESLLLSERKTSLI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLAA (HLA-A) (NM_001242758) Human Untagged Clone
SC331846 10 µg

HLAA (HLA-A) (NM_001242758) Human Untagged Clone

Sign In for Pricing
View Details
TMEM129 (NM_001127266) Human Untagged Clone
SC323002 10 µg

TMEM129 (NM_001127266) Human Untagged Clone

Sign In for Pricing
View Details
PYGO2 3'UTR GFP Stable Cell Line
TU069296 1.0 mL

PYGO2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human NFKB Activating Protein (NKAP) ELISA Kit
DL-NKAP-Hu-01 48 Tests

Human NFKB Activating Protein (NKAP) ELISA Kit

Sign In for Pricing
View Details
Human NFKB Activating Protein (NKAP) ELISA Kit
DL-NKAP-Hu-02 96 Tests

Human NFKB Activating Protein (NKAP) ELISA Kit

Sign In for Pricing
View Details
CB-TH
E-PP-0939-01 1 mg

CB-TH

Sign In for Pricing
View Details