Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat CD320 antigen (Cd320)

This Recombinant Rat CD320 antigen (Cd320) spans the amino acid sequence from region 29-264.

Product Specifications

Product Name Alternative

CD320 antigen, Transcobalamin receptor, TCblR, CD_antigen= CD320

UniProt

Q5HZW5

Expression Region

29-264

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APAPTSAPAHTLVQVSGPRAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRI EPCAQNRQCQPQPALPCSCDNISGCSAGSDKNLNCSRSPCQEGELRCILDDVCIPHTWRC DGHPDCPDSSDELSCDTDTETDKIFQEENATTSMSSMIVEKETSFRNVTVASAGHPSRNP NAYGVIAAAGVLSAILVSATILILLRLRGQGYLPPTGLLVAVKESLLLSERKTSLI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRBA2, ID (KRBA2, KRAB-A domain-containing protein 2) (PE) discontinued
037595-PE 200 µL

KRBA2, ID (KRBA2, KRAB-A domain-containing protein 2) (PE) discontinued

Sign In for Pricing
View Details
SPG34 3'UTR Lenti-reporter-Luc Vector
45299081 1.0 µg

SPG34 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PNRC1 siRNA Oligos set (Human)
37127171 3x 5 nmol

PNRC1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
GLUL (Chinese Hamster) CRISPR Knock Out CHO-K1 Cell Line-T1-1
T9857 1x106 cells / 1.0 mL

GLUL (Chinese Hamster) CRISPR Knock Out CHO-K1 Cell Line-T1-1

Sign In for Pricing
View Details
Genorise® Recombinant Hamster GDF-15 Protein
GR237009 5 µg

Genorise® Recombinant Hamster GDF-15 Protein

Sign In for Pricing
View Details
RNASEA (Ribonuclease A) Mouse ELISA Kit
G8404 96 Tests

RNASEA (Ribonuclease A) Mouse ELISA Kit

Sign In for Pricing
View Details