Recombinant Human Chloride intracellular channel protein 3 (CLIC3)
This Recombinant Human Chloride intracellular channel protein 3 (CLIC3) spans the amino acid sequence from region 1-236.
Product Specifications
Product Name Alternative
Chloride intracellular channel protein 3
UniProt
O95833
Expression Region
1-236
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPV PAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKL HIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471380-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401857-500 1x 500 µL
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details