Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synapse differentiation-inducing gene protein 1-like (Syndig1l)

This Recombinant Mouse Synapse differentiation-inducing gene protein 1-like (Syndig1l) spans the amino acid sequence from region 1-237.

Product Specifications

Product Name Alternative

Synapse differentiation-inducing gene protein 1-like, Capucin, Caudate and putamen-enriched protein, Synapse differentiation-induced protein 2, Transmembrane protein 90A

UniProt

Q3USQ7

Expression Region

1-237

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLSELQNPLLPRSPTHLHRPYPYPEAPPGWSCQEQLYSFLLGGAGPARAHQLLDPGSL QLAVEAWYRPSCLLGRDKVKEPKAGSCETSFTEAREPLAGPAEEGSEPGQAAEDVTIHTV SYGVQEELQGQEDSQEEESDGTSSESECEDAFLTLPPRDHLGLTLFSMLCCFWPLGIAAF YFSQGTSKAISKGDFRLASTTSRRALFLATLSIAVGAGLYVAVVVALAAYMSQNGHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-100 1x 100 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-500 1x 500 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details