Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Uncharacterized protein HI_0939 (HI_0939)

This Recombinant Haemophilus influenzae Uncharacterized protein HI_0939 (HI_0939) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Uncharacterized protein HI_0939

UniProt

P44080

Expression Region

1-238

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKVLLKGQTLLALMISLSLSSLLLLSISHFYVQIQTQNQHMLLHLKLQAELQRTLQLIG KDLRRLGFRALNAKLTESNLSLFELDEQGTAIFISQEDNAPPNSCVLFFYDLNKNGCIGK GSPKTCMKKGKNTSKSSTEELFGYKVSNKMIKTKLTYQSVIPTNCTAETCKRAFQQTACN AGGGWADLLDNNEYEITRLQFNWLIEGKGLEIKLKGNLKQTPNISYETSLVVVLWNQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details