Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0281105 (DDB_G0281105)

This Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0281105 (DDB_G0281105) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

Putative uncharacterized transmembrane protein DDB_G0281105

UniProt

Q54UF5

Expression Region

1-239

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFIYLFKKESTLQNCINELKLKNPGKEIKIHCYFDFRVNGEDKKTTFCLLKLESNIEIP YETFEILNRKQFEKKFNGLENKLEIKNIPSTSSSPSSSQLFLTLPATSQSSQPKSTNSST ESSSIGQFKNQVDENEINLNKNKIDEFQKDVISLQQKVSSLFQQYNKENEKNKTLNQIFD IQNKIQKMQQQIHFIQNNQESFITLFINYKVKIGSAFIIYIFYNVLFFIIVRFNSFFFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-100 1x 100 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-500 1x 500 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-500 1x 500 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF405S conjugate, 0.1mg/mL
BNC040749-100 1x 100 µL

CD8 (C8/144B), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF640R conjugate, 0.1mg/mL
BNC401788-100 1x 100 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details