Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB8 (virB8)

This Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB8 (virB8) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB8

UniProt

Q9RPX7

Expression Region

1-239

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGI GIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWY TLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRF AKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LARG (ARHGEF12) Human shRNA Plasmid Kit (Locus ID 23365)
TR306609 1 Kit

LARG (ARHGEF12) Human shRNA Plasmid Kit (Locus ID 23365)

Sign In for Pricing
View Details
Recombinant FKBP5 Antibody
RC-5387-01 50 μL

Recombinant FKBP5 Antibody

Sign In for Pricing
View Details
Recombinant FKBP5 Antibody
RC-5387-02 100 µL

Recombinant FKBP5 Antibody

Sign In for Pricing
View Details
Recombinant FKBP5 Antibody
RC-5387-03 1 mL

Recombinant FKBP5 Antibody

Sign In for Pricing
View Details
Mouse mmu-miR-3967 miRNA Agomir
abx883623-01 5 nmol

Mouse mmu-miR-3967 miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-3967 miRNA Agomir
abx883623-02 10 nmol

Mouse mmu-miR-3967 miRNA Agomir

Sign In for Pricing
View Details