Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypbE (ypbE)

This Recombinant Bacillus subtilis Uncharacterized protein ypbE (ypbE) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

Uncharacterized protein ypbE

UniProt

P50731

Expression Region

1-240

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNMSRVERRKAQNLYEDQNAALADDYVDDGESLPTRQSVKNQREQKKKQGKTKTPLFTV LAVIFVFVPVIVLVTLFYLKSHPDNHDDYEDVFIDSSQSKYEVVPKSEDKNDTADTKETA LQKESKKEPEDSKPKEQTAADKKQTAVAEKEDSPNKEEATAAAASSSQSTVQQQEQPAEP VQNVPNRVVKHTVQKKETLYRISMKYYKSRTGEEKIRAYNHLNGNDVYTGQVLDIPLMDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPKAP1 Peptide - N-terminal region
orb2001927 100 µg

MAPKAP1 Peptide - N-terminal region

Sign In for Pricing
View Details
SRPR, CT (SRPR, Signal recognition particle receptor subunit alpha, Docking protein alpha) (FITC) discontinued
042311-FITC 200 µL

SRPR, CT (SRPR, Signal recognition particle receptor subunit alpha, Docking protein alpha) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Cstdc2 qPCR Primer Pair
QM45754S 200 Tests

Mouse Cstdc2 qPCR Primer Pair

Sign In for Pricing
View Details
HMGN4 Rabbit Polyclonal Antibody (Biotin)
orb454977 100 µL

HMGN4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
mmu-miR-7668-3p miRNA Inhibitor
MBS8297179-01 10 nmol

mmu-miR-7668-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-7668-3p miRNA Inhibitor
MBS8297179-02 20 nmol

mmu-miR-7668-3p miRNA Inhibitor

Sign In for Pricing
View Details