Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypbE (ypbE)

This Recombinant Bacillus subtilis Uncharacterized protein ypbE (ypbE) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

Uncharacterized protein ypbE

UniProt

P50731

Expression Region

1-240

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNMSRVERRKAQNLYEDQNAALADDYVDDGESLPTRQSVKNQREQKKKQGKTKTPLFTV LAVIFVFVPVIVLVTLFYLKSHPDNHDDYEDVFIDSSQSKYEVVPKSEDKNDTADTKETA LQKESKKEPEDSKPKEQTAADKKQTAVAEKEDSPNKEEATAAAASSSQSTVQQQEQPAEP VQNVPNRVVKHTVQKKETLYRISMKYYKSRTGEEKIRAYNHLNGNDVYTGQVLDIPLMDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS22 Protein Vector (Mouse) (pPB-N-His)
PV223875 500 ng

RGS22 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human NLGN4X  Recombinant Protein C-6His Tag Lyophilized 10ug
IHUNLGN4XRC6HISLY10UG 10 µg

Human NLGN4X Recombinant Protein C-6His Tag Lyophilized 10ug

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase 13 Antibody
MBS8248140-01 0.03 mL

Anti-Carbonic Anhydrase 13 Antibody

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase 13 Antibody
MBS8248140-02 0.05 mL

Anti-Carbonic Anhydrase 13 Antibody

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase 13 Antibody
MBS8248140-03 0.1 mL

Anti-Carbonic Anhydrase 13 Antibody

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase 13 Antibody
MBS8248140-04 0.2 mL

Anti-Carbonic Anhydrase 13 Antibody

Sign In for Pricing
View Details