Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B-cell receptor-associated protein 29 (Bcap29)

This Recombinant Mouse B-cell receptor-associated protein 29 (Bcap29) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 29, BCR-associated protein 29, Bap29

UniProt

Q61334

Expression Region

1-240

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIFSFSVWGKIASFWNKAFLTIIILLI ILFLDAVREVRKYSSTNVVEKNSAIRPSAFEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKEIANKGVLKIQAENTNKAAKKFMEENEKLKLGLRNDNAEEHLLEAENKKLI ESKENLKTELKKASDALLKAQNDVMTMKIQSERLSKEYDRLLKEHSELQNRLEKEKKKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 Antibody
F44586-0.4ML 0.4 mL

CD45 Antibody

Sign In for Pricing
View Details
RBM12B Antibody
KC-41672-01 50 μL

RBM12B Antibody

Sign In for Pricing
View Details
RBM12B Antibody
KC-41672-02 100 µL

RBM12B Antibody

Sign In for Pricing
View Details
RBM12B Antibody
KC-41672-03 1 mL

RBM12B Antibody

Sign In for Pricing
View Details
IDNK (NM_001001551) Human Over-expression Lysate
LC424376 20 µg

IDNK (NM_001001551) Human Over-expression Lysate

Sign In for Pricing
View Details
Cx40 / GJA5 Recombinant Rabbit monoclonal Antibody
HA751374 100 µL

Cx40 / GJA5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details