Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protein liaF (liaF)

This Recombinant Bacillus subtilis Protein liaF (liaF) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Protein liaF

UniProt

O32199

Expression Region

1-241

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKQLLGLIIALFGISMFLQIIGIGDLLFWPLFFLIAGYFLKKYSRDWLGSVMYIFAAF LFLKNLFSITFNLFGYAFAAFLIYAGYRLIKGKPIFEPNEKQVNLNKKEHHEPPKDVKHP DMRSFFIGELQMMKQPFDLNDLNVSGFIGDIKIDLSKAMIPEGESTIVISGVIGNVDIYV PSDLEVAVSSAVFIGDINLIGSKKSGLSTKVYAASTDFSESKRRVKVSVSLFIGDVDVKY V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLIG3 Rabbit Polyclonal Antibody
AP18144PU-N 400 µL

OLIG3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NRAP Polyclonal Antibody
E-AB-90493-01 60 µL

NRAP Polyclonal Antibody

Sign In for Pricing
View Details
NRAP Polyclonal Antibody
E-AB-90493-02 120 µL

NRAP Polyclonal Antibody

Sign In for Pricing
View Details
NRAP Polyclonal Antibody
E-AB-90493-03 200 µL

NRAP Polyclonal Antibody

Sign In for Pricing
View Details
2-Diisopropylaminoethyl Ester Xanthene-9-carboxylic Acid Hydrochloride
TRC-D455420-2.5MG 2.5 mg

2-Diisopropylaminoethyl Ester Xanthene-9-carboxylic Acid Hydrochloride

Sign In for Pricing
View Details
Calcitonin, Salmon
TRC-C144558-5MG 5 mg

Calcitonin, Salmon

Sign In for Pricing
View Details