Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDC/CCL22, Human

MDC/CCL22 Protein, Human is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. MDC/CCL22 Protein, Human is a recombinant human MDC/CCL22 (G25-Q93) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MDC/CCL22 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl22-mdc-protein-human.html

Purity

98.0

Smiles

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Molecular Formula

6367 (Gene_ID) O00626 (G25-Q93) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[2]Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18 (11) :2306.|[3]Jillian R Richter, et al. Macrophage-derived chemokine (CCL22) is a novel mediator of lung inflammation following hemorrhage and resuscitation. Shock. 2014 Dec;42 (6) :525-31.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (TP53/3156R), CF640R conjugate, 0.1mg/mL
BNC403156-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/3156R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-SPS | Sucrose phosphate synthase, global, DyLight® 594 conjugated (40 µg)
AS03 035-DL594 40 µg

Anti-SPS | Sucrose phosphate synthase, global, DyLight® 594 conjugated (40 µg)

Sign In for Pricing
View Details
Col11a2 Mouse Gene Knockout Kit (CRISPR)
KN503615 1 Kit

Col11a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ube2k activation kit by CRISPRa
GA205549 1 Kit

Mouse Ube2k activation kit by CRISPRa

Sign In for Pricing
View Details
APMAP (NM_020531) Human Over-expression Lysate
LY402795 100 µg

APMAP (NM_020531) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Chloro Acesulfame
TRC-C363250-250MG 250 mg

5-Chloro Acesulfame

Sign In for Pricing
View Details