Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDC/CCL22, Human

MDC/CCL22 Protein, Human is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. MDC/CCL22 Protein, Human is a recombinant human MDC/CCL22 (G25-Q93) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MDC/CCL22 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl22-mdc-protein-human.html

Purity

98.0

Smiles

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Molecular Formula

6367 (Gene_ID) O00626 (G25-Q93) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[2]Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18 (11) :2306.|[3]Jillian R Richter, et al. Macrophage-derived chemokine (CCL22) is a novel mediator of lung inflammation following hemorrhage and resuscitation. Shock. 2014 Dec;42 (6) :525-31.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATc4 CRISPR Activation Plasmid (h2)
sc-417766-ACT-2 20 µg

NFATc4 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
ARMH3 (NM_024541) Human 3' UTR Clone
SC217075 10 µg

ARMH3 (NM_024541) Human 3' UTR Clone

Sign In for Pricing
View Details
MAP3K1 Protein Vector (Rat) (pPB-C-His)
PV280962 500 ng

MAP3K1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti-HLA-G FITC
1F-292-C100 0.1 mg

Anti-HLA-G FITC

Sign In for Pricing
View Details
Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (BU20a) [Alexa Fluor 594]
NBP2-34567AF594 0.1 mL

Mouse Monoclonal Bromodeoxyuridine/BrdU Antibody (BU20a) [Alexa Fluor 594]

Sign In for Pricing
View Details
Recombinant Campylobacter Concisus rpsG Protein (aa 1-156)
VAng-Lsx5896-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Concisus rpsG Protein (aa 1-156)

Sign In for Pricing
View Details