Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii B-cell receptor-associated protein 29 (BCAP29)

This Recombinant Pongo abelii B-cell receptor-associated protein 29 (BCAP29) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 29, BCR-associated protein 29, Bap29

UniProt

Q5R9U7

Expression Region

1-241

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL VEDQQKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tumor Necrosis Factor Ligand Superfamily, Member 13 ELISA Kit
MBS101232-01 48 Well

Human Tumor Necrosis Factor Ligand Superfamily, Member 13 ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 13 ELISA Kit
MBS101232-02 96 Well

Human Tumor Necrosis Factor Ligand Superfamily, Member 13 ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 13 ELISA Kit
MBS101232-03 5x 96 Well

Human Tumor Necrosis Factor Ligand Superfamily, Member 13 ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Ligand Superfamily, Member 13 ELISA Kit
MBS101232-04 10x 96 Well

Human Tumor Necrosis Factor Ligand Superfamily, Member 13 ELISA Kit

Sign In for Pricing
View Details
HOXD11 Human Over-expression Lysate
orb1370606 20 µg

HOXD11 Human Over-expression Lysate

Sign In for Pricing
View Details
RPL21P132 CRISPR Knock Out 293T Cell Line (Human)
41011141 1x 10^6 Cells / 1.0 mL

RPL21P132 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details