Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii B-cell receptor-associated protein 29 (BCAP29)

This Recombinant Pongo abelii B-cell receptor-associated protein 29 (BCAP29) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 29, BCR-associated protein 29, Bap29

UniProt

Q5R9U7

Expression Region

1-241

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL VEDQQKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spindly Rabbit Polyclonal Antibody (FITC)
orb7748 100 µL

Spindly Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rat PaRathyroid Hormone Related Protein (PTHrP ELISA Ki
QY-E11310 96 Tests

Rat PaRathyroid Hormone Related Protein (PTHrP ELISA Ki

Sign In for Pricing
View Details
Iodotyrosine deiodinase 1
orb1640100-01 50 µg

Iodotyrosine deiodinase 1

Sign In for Pricing
View Details
Iodotyrosine deiodinase 1
orb1640100-02 100 µg

Iodotyrosine deiodinase 1

Sign In for Pricing
View Details
Iodotyrosine deiodinase 1
orb1640100-03 1 mg

Iodotyrosine deiodinase 1

Sign In for Pricing
View Details
S.cerevisiae Antigen Concentrate
F138H 500 µL

S.cerevisiae Antigen Concentrate

Sign In for Pricing
View Details