Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell receptor-associated protein 29 (BCAP29)

This Recombinant Human B-cell receptor-associated protein 29 (BCAP29) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 29, BCR-associated protein 29, Bap29

UniProt

Q9UHQ4

Expression Region

1-241

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL VEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZHX1, CT (ZHX1, Zinc fingers and homeoboxes protein 1) (MaxLight 550) discontinued
044082-ML550 100 µL

ZHX1, CT (ZHX1, Zinc fingers and homeoboxes protein 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
EIF2AK1 siRNA (Mouse)
orb1847364-01 15 nmol

EIF2AK1 siRNA (Mouse)

Sign In for Pricing
View Details
EIF2AK1 siRNA (Mouse)
orb1847364-02 30 nmol

EIF2AK1 siRNA (Mouse)

Sign In for Pricing
View Details
VPS26 (VPS26A) (NM_004896) Human Tagged Lenti ORF Clone
RC205353L4 10 µg

VPS26 (VPS26A) (NM_004896) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Prl7d1 Protein Lysate (Mouse) with C-HA Tag
37698034 100 µg

Prl7d1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Girdin Polyclonal Antibody
E20-71907 100 µg

Girdin Polyclonal Antibody

Sign In for Pricing
View Details